Active Recombinant Mouse IL13 Protein

• Cat.No.: IL13-133M
• Product Overview: Recombinant Mouse IL13 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Interleukin 13 (IL-13) is a cytokine secreted from type 2 T helper (Th2) cells. IL-13 has overlapping functions with interleukin 4 (IL-4), including the induction of immunoglobulin E (IgE) secretion from B cells, and the inhibition of interleukin 1 beta (IL-1β), tumor necrosis factor alpha (TNF-α), interleukin 8 (IL-8), and interleukin 6 (IL-6) inflammatory cytokine expression. IL-13 also regulates immune cell inflammation in response to the pathophysiological changes of surrounding non-immune cells. The IL-13 receptor consists of the IL-4Ra and IL-13Ra1 subunits. IL-13 can also bind the IL-13Ra2 receptor with high affinity. IL-13 functions are mediated through the JAK/STAT signaling pathway. Human and mouse IL-13 are cross-reactive.
• Bio-activity: TF-1 cell proliferation, ≤10 ng/mL
• Molecular Mass: Monomer, 12.3 kDa (111 aa)
• AA Sequence: MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile 20 mM HCl at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Il13 interleukin 13 [ Mus musculus (house mouse) ]
• Official Symbol: IL13
• Synonyms: IL13; interleukin 13; interleukin-13; T-cell activation protein P600; Il-13
• Gene ID: 16163
• mRNA Refseq: NM_008355
• Protein Refseq: NP_032381
• UniProt ID: P20109