Active Recombinant Mouse Il12b Protein
Cat.No. : | Il12b-257I |
Product Overview : | Recombinant Mouse Il12b Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals throughtheIL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.15 ng/mL, measured in a cell proliferation assay using 2D6 cells. |
Molecular Mass : | 27-29 kDa (p35) and 45-50 kDa (p40), observed by reducing SDS-PAGE. |
AA Sequence : | p35:RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA p40:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant murineInterleukin-12 (IL-12), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-12 (IL-12), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il12b interleukin 12b [ Mus musculus ] |
Official Symbol | Il12b |
Synonyms | IL12B; interleukin 12b; interleukin-12 subunit beta; CLMF p40; IL-12 p40; IL-12 subunit p40; IL-23 subunit p40; cytotoxic lymphocyte maturation factor 40 kDa subunit; p40; Il-12b; Il12p40; Il-12p40; |
Gene ID | 16160 |
mRNA Refseq | NM_008352 |
Protein Refseq | NP_032378 |
UniProt ID | P43432 |
◆ Recombinant Proteins | ||
IL12B-435M | Recombinant Mouse Il12b, LEVLFQ tagged | +Inquiry |
Il12b-4492M | Recombinant Mouse Il12b Protein, His (Fc)-Avi-tagged | +Inquiry |
IL12B-3091H | Recombinant Human IL12B protein, GST-tagged | +Inquiry |
IL12B-5437S | Recombinant Sheep IL12B protein, His-tagged | +Inquiry |
Il12b-1104R | Recombinant Rat Il12b Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12B-2731HCL | Recombinant Human IL12B cell lysate | +Inquiry |
IL12B-1197RCL | Recombinant Rat IL12B cell lysate | +Inquiry |
IL12B-1101MCL | Recombinant Mouse IL12B cell lysate | +Inquiry |
IL12B-1000MCL | Recombinant Marmoset IL12B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il12b Products
Required fields are marked with *
My Review for All Il12b Products
Required fields are marked with *
0
Inquiry Basket