Active Recombinant Mouse Igf1 Protein

• Cat.No.: Igf1-080M
• Product Overview: Purified recombinant protein of Mouse insulin-like growth factor 1 (Igf1), transcript variant 3 without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes a member of the insulin-like growth factor (IGF) family of proteins that promote growth and development during fetal and postnatal life. This gene is predominantly expressed in the liver and the encoded protein undergoes proteolytic processing to generate a disulfide-linked mature polypeptide. Transgenic disruption of this gene in mice results in reduced postnatal survival and severe growth retardation. Mice lacking the encoded protein exhibit generalized organ hypoplasia including underdevelopment of the central nervous system and developmental defects in bone, muscle and reproductive systems. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.
• Bio-activity: The ED50 was determined a cell proliferation assay using FDC-P1 cells is<2.0 ng/ml, corresponding to a specific activity of >5 x 10^5 units/mg.
• Molecular Mass: 7.6 kDa
• AA Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Igf1 insulin-like growth factor 1 [ Mus musculus (house mouse) ]
• Official Symbol: Igf1
• Synonyms: Igf1; insulin-like growth factor 1; Igf-1; Igf-I; C730016P09Rik; insulin-like growth factor I; somatomedin
• Gene ID: 16000
• mRNA Refseq: NM_001111274
• Protein Refseq: NP_001104744
• UniProt ID: Q8CAR0