Active Recombinant Mouse Gm13306 Protein
Cat.No. : | Gm13306-012M |
Product Overview : | Purified recombinant protein of Mouse predicted gene 13306 (Gm13306), transcript variant 2 without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10. |
Bio-activity : | Determined by its ability to chemoattract human peripheral blood lymphocytes using a concentration range of 10.0-100.0 ng/ml. |
Molecular Mass : | 10.9 kDa |
AA Sequence : | LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Gm13306 predicted gene 13306 [ Mus musculus (house mouse) ] |
Official Symbol | Gm13306 |
Synonyms | Gm13306; predicted gene 13306; chemokine (C-C motif) ligand 27b |
Gene ID | 100039863 |
mRNA Refseq | NM_001164046 |
Protein Refseq | NP_001157518 |
UniProt ID | Q9Z1X0 |
◆ Recombinant Proteins | ||
GM13306-3654M | Recombinant Mouse GM13306 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gm13306-012M | Active Recombinant Mouse Gm13306 Protein | +Inquiry |
GM13306-6582M | Recombinant Mouse GM13306 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gm13306 Products
Required fields are marked with *
My Review for All Gm13306 Products
Required fields are marked with *
0
Inquiry Basket