Active Recombinant Mouse FLT3L Protein

Cat.No. : FLT3L-99M
Product Overview : Recombinant Mouse FLT3L Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Fms-related tyrosine kinase 3 ligand (FLT-3 ligand) is a growth factor that regulates hematopoietic cell proliferation. FLT-3 ligand signaling is transmitted through the fms-related tyrosine kinase 3 (FLT-3) receptor. FLT-3 ligand promotes the long-term expansion and differentiation of pro-B cells in the presence of interleukin 7 (IL-7) or in combination of IL-7 and interleukin 3 (IL-3).
Bio-activity : OCI-AML5 cell proliferation, ≤10 ng/mL; ≥1.0 x 10^5 units/mg
Molecular Mass : Monomer, 18.6 kDa (163 aa)
AA Sequence : MTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ]
Official Symbol FLT3L
Synonyms Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand
Gene ID 14256
mRNA Refseq NM_013520
Protein Refseq NP_038548
UniProt ID P49772

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FLT3L Products

Required fields are marked with *

My Review for All FLT3L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon