Active Recombinant Mouse Fgf7 Protein (163 aa)

• Cat.No.: Fgf7-344F
• Product Overview: Recombinant mouse Keratinocyte Growth Factor (rmKGF) produced in E. coli is a single non-glycosylated polypeptide chain containing 163 amino acids. A fully biologically active molecule, rmKGF has a molecular mass of 18.7 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 163
• Description: Keratinocyte Growth Factor (KGF) is a highly specific epithelial mitogen produced by fibroblasts and mesenchymal stem cells. KGF belongs to the heparin binding Fibroblast Growth Factor (FGF) family, and is known as FGF-7. However, in contrast to FGF-1, which binds to all known FGF receptors with high affinity, KGF only binds to a splice variant of the FGF receptor, FGFR2-IIIb. FGFR2-IIIb is expressedby most epithelial cells, indicating KGF's roleas a paracrine mediator. KGF induces the differentiation and proliferation of various epithelial cells such as keratinocytes in the epidermis, hair follicles and sebaceous glands., KGF is also responsible for wound repair of various tissuesincluding lung, bladder, and kidney.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 2 ng/mL, measured by a cell proliferation assay using 4MBr-5 cells, corresponding to a specific activity of > 5.0 × 10^5 units/mg.
• Molecular Mass: 18.7 kDa, observed by reducing SDS-PAGE.
• AA Sequence: CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant mouse Keratinocyte Growth Factor (rmKGF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmKGF remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in PBS at 100 μg/mL.

Gene Information

• Gene Name: Fgf7 fibroblast growth factor 7 [ Mus musculus ]
• Official Symbol: Fgf7
• Synonyms: FGF7; fibroblast growth factor 7; FGF-7; HBGF-7; Keratinocyte growth factor; heparin-binding growth factor 7; Kgf
• Gene ID: 14178
• mRNA Refseq: NM_008008
• Protein Refseq: NP_032034
• UniProt ID: P36363