Recombinant Human FGF7 protein

Cat.No. : FGF7-28647TH
Product Overview : Recombinant Human FGF7 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 163
Description : Human KGF-1 also known as Fibroblast growth factor 7 (FGF-7), is encoded by the FGF7 gene. KGF-1 only binds to the b splice form of the tyrosine kinase receptor, FGFR2b/KGFR. Affinity between KGF-1 and its receptor can be increased by heparin or heparan sulfate proteoglycan. FGF-10, also called keratinocyte growth factor 2 (KGF-2), shares 51 % amino acid sequence identity and similar function to KGF-1, but uses an additional receptor, FGFR2c. KGF-1 plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. KGF-1 actives on keratinocytes, and exhibits mitogenic activity for epidermal cells, but essentially no activity for fibroblasts. KGF-1 has species crossactive, human KGF-1 shares 96 % amino acid sequence identity with murine, and 92 % with rat.
Form : Lyophilized from a 0.2μm filtered solution in 20 mM PB, 0.5 M NaCl, pH 8.0.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 18.9 kDa, a single, non-glycosylated polypeptide chain containing 163 amino acids.
AA Sequence : CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Endotoxin : Less than 1 EU/µg of rHuKGF-1/FGF-7 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF7
Official Symbol FGF7
Synonyms FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7;
Gene ID 2252
mRNA Refseq NM_002009
Protein Refseq NP_002000
MIM 148180
UniProt ID P21781

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF7 Products

Required fields are marked with *

My Review for All FGF7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon