Active Recombinant Mouse Fgf23 Protein

• Cat.No.: Fgf23-7408M
• Product Overview: Recombinant murine FGF-23 is a 25.5 kDa globular protein containing 228 amino acid residues without tag was expressed in E. coli.

Specification

• Description: This gene encodes a member of the fibroblast growth factor family. The encoded protein regulates phosphate homeostasis and vitamin D metabolism. Mutation of the related gene in humans causes autosomal dominant hypophosphatemic rickets (ADHR). The secreted protein is further cleaved into N- and C-terminal chains, which results in loss of function.
• Source: E. coli
• Species: Mouse
• Form: Lyophilized (0.2 μm Sterile filtered) purified protein
• Bio-activity: Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The expected ED50 for this effect is 0.3-0.5 μg/mL, in the presence of murine Klotho and heparin.
• Molecular Mass: 25.5 kDa
• AA Sequence: MYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRSAEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV
• Purity: > 95 % pure by SDS-PAGE and HPLC analyses
• Stability: Shelf life: one year from despatch.
• Storage: Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term.
  After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term.
  Avoid repeated freezing and thawing.

Gene Information

• Gene Name: Fgf23 fibroblast growth factor 23 [ Mus musculus (house mouse) ]
• Official Symbol: Fgf23
• Synonyms: Fgf23; fibroblast growth factor 23; Fgf8b; fibroblast growth factor 23; FGF-23; fibroblast growth factor 8b
• Gene ID: 64654
• mRNA Refseq: NM_022657
• Protein Refseq: NP_073148
• UniProt ID: Q9EPC2