Active Recombinant Mouse Fgf2 Protein

Cat.No. : Fgf2-544M
Product Overview : Recombinant Mouse Fgf2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : Murine bFGF, encoded by the FGF2 gene, is a member of the fibroblast growth factor (FGF) family. Fibroblast growth factor was found in pituitary extracts in 1973 and then tested in a bioassay that caused fibroblasts to proliferate. After further fractionating the extract using acidic and basic pH, two different forms have isolated that named "acidic fibroblast growth factor" (FGF-1) and "basic fibroblast growth factor" (FGF-2). Murine bFGF shares 95 % amino acid sequence identity with human bFGF. Affinity between bFGF and its receptors can be increased by heparin or heparan sulfate proteoglycan. bFGF plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. bFGF are also involved in a variety of biological processes, including embryonic development , morphogenesis, tissue repair, tumor growth and invasion. Additionally, bFGF is frequently used for a critical component of cell culture medium, e.g., human embryonic stem cell culture medium, serum-free culture systems.
Form : Sterile Filtered White lyophil
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb c 3T3 cells is less than 1.0 ng/mL, corresponding to a specific activity of > 1.0×10^6 IU/mg.
Molecular Mass : Approximately 16.5 kDa
AA Sequence : MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin : Less than 1 EU/μg of rMubFGF as determined by LAL method.
Purity : > 98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4.
Gene Name Fgf2 fibroblast growth factor 2 [ Mus musculus (house mouse) ]
Official Symbol Fgf2
Synonyms FGF2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2; Fgfb; bFGF; Fgf-2;
Gene ID 14173
mRNA Refseq NM_008006
Protein Refseq NP_032032
UniProt ID P15655

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Fgf2 Products

Required fields are marked with *

My Review for All Fgf2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon