Active Recombinant Mouse FGF2 Protein
Cat.No. : | FGF2-83M |
Product Overview : | Recombinant Mouse FGF2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Basic fibroblast growth factor (FGF-basic), also known as FGF-2, is expressed by endothelial cells and is a mediator of angiogenesis. FGF-basic also has cardioprotective functions during heart injury. The application of FGF-basic is a critical component for human embryonic stem cell culture systems and is necessary for maintaining human embryonic stem cells in an undifferentiated state. |
Bio-activity : | 3T3 cell proliferation, ≤ED50≤2.5 ng/mL |
Molecular Mass : | Monomer, 16.5 kDa (146 aa) |
AA Sequence : | MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Fgf2 fibroblast growth factor 2 [ Mus musculus (house mouse) ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2; Fgfb; bFGF; Fgf-2; |
Gene ID | 14173 |
mRNA Refseq | NM_008006 |
Protein Refseq | NP_032032 |
UniProt ID | P15655 |
◆ Recombinant Proteins | ||
FGF2-6739C | Recombinant Chicken FGF2 protein, His-tagged | +Inquiry |
FGF2-4422B | Recombinant Bovine FGF2 protein, His-tagged | +Inquiry |
FGF2-14H | Active Recombinant Human FGF2 Protein | +Inquiry |
Fgf2-4025M | Recombinant Mouse Fgf2 Protein (Pro143-Ser288), C-His tagged | +Inquiry |
FGF2-21H | Active Recombinant Human FGF2 Protein (Formulation I- Animal Free-Ready-to-Use, 134-288, 154 amino acid) | +Inquiry |
◆ Native Proteins | ||
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
0
Inquiry Basket