Active Recombinant Mouse Fgf2 Protein (146 aa)

• Cat.No.: Fgf2-398F
• Product Overview: Recombinant mouse Fibroblast Growth Factor-basic (rmFGF-basic) produced in E. coli is a single non-glycosylated polypeptide chain containing 146 amino acids. A fully biologically active molecule, rmFGF-basic has a molecular mass of 16.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 146
• Description: Fibroblast Growth Factor-basic (FGF-basic), also known as HBGF-2, is a non-glycosylated heparin-binding growth factor that belongs to the FGF family. FGF-basic is present in basement membranes and in the subendothelial extracellular matrix of blood vessels. FGF-basic signals through FGFR1, 2, 3 and 4 that plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 2.0 × 10^6 units/mg.
• Molecular Mass: 16.4 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant mouse Fibroblast Growth Factor-basic (rmFGF-basic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-basic should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Fgf2 fibroblast growth factor 2 [ Mus musculus ]
• Official Symbol: Fgf2
• Synonyms: FGF2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2; Fgfb; bFGF; Fgf-2
• Gene ID: 14173
• mRNA Refseq: NM_008006
• Protein Refseq: NP_032032
• UniProt ID: P15655