Active Recombinant Mouse Fgf2 Protein (146 aa)
Cat.No. : | Fgf2-398F |
Product Overview : | Recombinant mouse Fibroblast Growth Factor-basic (rmFGF-basic) produced in E. coli is a single non-glycosylated polypeptide chain containing 146 amino acids. A fully biologically active molecule, rmFGF-basic has a molecular mass of 16.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 146 |
Description : | Fibroblast Growth Factor-basic (FGF-basic), also known as HBGF-2, is a non-glycosylated heparin-binding growth factor that belongs to the FGF family. FGF-basic is present in basement membranes and in the subendothelial extracellular matrix of blood vessels. FGF-basic signals through FGFR1, 2, 3 and 4 that plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 2.0 × 10^6 units/mg. |
Molecular Mass : | 16.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant mouse Fibroblast Growth Factor-basic (rmFGF-basic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-basic should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Fgf2 fibroblast growth factor 2 [ Mus musculus ] |
Official Symbol | Fgf2 |
Synonyms | FGF2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2; Fgfb; bFGF; Fgf-2; |
Gene ID | 14173 |
mRNA Refseq | NM_008006 |
Protein Refseq | NP_032032 |
UniProt ID | P15655 |
◆ Recombinant Proteins | ||
FGF2-590H | Recombinant Human FGF2 protein | +Inquiry |
FGF2-169H | Active Recombinant Human FGF2 | +Inquiry |
FGF2-1967R | Recombinant Rat FGF2 Protein | +Inquiry |
FGF2-5H | Active Recombinant Human Basic Fibroblast Growth Factor | +Inquiry |
FGF2-1968M | Recombinant Mouse FGF2 Protein | +Inquiry |
◆ Native Proteins | ||
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf2 Products
Required fields are marked with *
My Review for All Fgf2 Products
Required fields are marked with *
0
Inquiry Basket