Active Recombinant Mouse Fasl Protein, His-Tagged

• Cat.No.: Fasl-01M
• Product Overview: Recombinant mouse Fasl Protein, His-tagged was expressed in E. coli cell

Specification

• Description: FasL is a member of the TNF superfamily, and is mainly expressed on the cell surface of activated T cells. FasL induces apoptosis in Fas-bearing cells by binding to Fas Receptor. FasL has the ability to leads to down-regulation of the immune response through killing T cells and activated B cells. The mechanism of Fas-induced apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD, followed by processing of the pro-enzyme into active forms. These active caspases then cleave various cellular substrates, leading to the eventual cell death.
• Source: Escherichia coli
• Species: Mouse
• Tag: His
• Form: Lyophilized powder
• AA Sequence: QIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDL
  VLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL with polyhistidine tag and sumo tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce apoptosis in Jurkat cells. The ED50 for this effect is <1 μg /mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Fasl Fas ligand (TNF superfamily, member 6) [ Mus musculus (house mouse) ]
• Official Symbol: Fasl
• Synonyms: gld; CD178; CD95L; Fas-L; Faslg; CD95-L; Tnfsf6; Tnlg1a; APT1LG1
• Gene ID: 14103
• mRNA Refseq: NM_001205243.1
• Protein Refseq: P_001192172.1
• UniProt ID: Q99PH8