Active Recombinant Mouse Fap protein, His-tagged
Cat.No. : | FAP-584M |
Product Overview : | Recombinant Mouse Fap fused with His tag was expressed in HEK293F. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Description : | This gene belongs to the serine protease family. The encoded protein is an inducible cell-surface bound glycoprotein specifically expressed in tumor-associated fibroblasts and pericytes of epithelial tumors and has protease and gelatinase activity. The protein plays a role in remodeling of the extracellular matrix (ECM) and may affect tumorigenesis and tissue repair. Alternately spliced transcript variants of this gene are described in the literature (PMID 9139873), but the full-length sequence of these variants is not available. |
Form : | Lyophilized from sterile 25mM Tris, 250mM NaCl, pH 8.2 |
Bio-activity : | The specific activity(kcat)is >1000 pmol/min/μg. kcat/Km>0.5×10E4 (M^-1s^-1)Measured by its ability to convert the substrate ZGPAMC to ZGlyPro and AMC. |
Molecular Mass : | ~90 kDa |
AA Sequence : | HHHHHHHHHHENLYFQLRPSRVYKPEGNTKRALTLKDILNGTFSYKTYFPNWISEQEYLHQSEDDNIVFYNIETR ESYIILSNSTMKSVNATDYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLQNGEFVRGYELPRPIQYLCWSPVG SKLAYVYQNNIYLKQRPGDPPFQITYTGRENRIFNGIPDWVYEEEMLATKYALWWSPDGKFLAYVEFNDSDIPII AYSYYGDGQYPRTINIPYPKAGAKNPVVRVFIVDTTYPHHVGPMEVPVPEMIASSDYYFSWLTWVSSERVCLQWL KRVQNVSVLSICDFREDWHAWECPKNQEHVEESRTGWAGGFFVSTPAFSQDATSYYKIFSDKDGYKHIHYIKDTV ENAIQITSGKWEAIYIFRVTQDSLFYSSNEFEGYPGRRNIYRISIGNSPPSKKCVTCHLRKERCQYYTASFSYKA KYYALVCYGPGLPISTLHDGRTDQEIQVLEENKELENSLRNIQLPKVEIKKLKDGGLTFWYKMILPPQFDRSKKY PLLIQVYGGPCSQSVKSVFAVNWITYLASKEGIVIALVDGRGTAFQGDKFLHAVYRKLGVYEVEDQLTAVRKFIE MGFIDEERIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASIYSERFMGLPTKDDNLEHYKNSTVMA RAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGISSGRSQNHLYTHMTHFLKQCFSL SD |
Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method |
Purity : | >95%, by SDS-PAGE under reducing conditions |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Gene Name | Fap fibroblast activation protein [ Mus musculus ] |
Official Symbol | Fap |
Synonyms | FAP; fibroblast activation protein; seprase; integral membrane serine protease; fibroblast activation protein alpha; |
Gene ID | 14089 |
mRNA Refseq | NM_007986 |
Protein Refseq | NP_032012 |
MIM | |
UniProt ID | P97321 |
Chromosome Location | 2 C1.3; 2 35.85 cM |
Function | endopeptidase activity; hydrolase activity; peptidase activity; peptidase activity; protease binding; serine-type endopeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
FAP-427H | Active Recombinant Human FAP protein, His-tagged | +Inquiry |
Fap-1018M | Recombinant Mouse Fap Protein, MYC/DDK-tagged | +Inquiry |
FAP-3281H | Recombinant Human FAP Protein (Ile523-Asp760), His tagged | +Inquiry |
FAP-1141HF | Recombinant Human FAP Protein, His-tagged, FITC conjugated | +Inquiry |
FAP-1446H | Active Recombinant Human FAP protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAP-1881HCL | Recombinant Human FAP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fap Products
Required fields are marked with *
My Review for All Fap Products
Required fields are marked with *
0
Inquiry Basket