Active Recombinant Mouse Entpd6 Protein, His-tagged

• Cat.No.: Entpd6-002M
• Product Overview: Recombinant mouse CD39L2, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Description: Ubiquitous expression in testis adult (RPKM 27.5), genital fat pad adult (RPKM 15.1) and 28 other tissues.
• Form: Liquid
• Bio-activity: Specific activity is > 80,000 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze GDP per minute at pH 7.5 at 25 centigrade.
• Molecular Mass: 47.3 kDa
• AA Sequence: KWHRASAAQAFFTIAGAASGARWTQQAFSSPGSAARGHEVFYGIMFDAGSTGTRIHVFQFARPPGETPTLTHETFKALKPGLSAYADDVEKSAQGIQELLNVAKQHIPYDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITVNFLTGSLKTPGSSSVGMLDLGGGSTQITFLPRVEGTLQASPPGHLTALQMFNRTYKLYSYSYLGLGLMSARLAILGGVEGKPAENDKELVSPCLSPRFRGEWEHAEVTYRISGQKAVGLYELCASRVSEVLRNKVHRTEEAQHVDFYAFSYYYDLAASFGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPPSSPFACMDLTYISLLLHEFGFPGDKVLKLARKIDNVETSWALGAIFHYIDSLKRQKVPAL
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Enzyme Activity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -81 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol

Gene Information

• Gene Name: Entpd6 ectonucleoside triphosphate diphosphohydrolase 6 [ Mus musculus (house mouse) ]
• Official Symbol: Entpd6
• Synonyms: Entpd6; ectonucleoside triphosphate diphosphohydrolase 6; Cd39l; NTPDa; Cd39l2; NTPDase-6; 2700026H11Rik; ectonucleoside triphosphate diphosphohydrolase 6; CD39 antigen-like 2; EC 3.6.1.6
• Gene ID: 12497
• mRNA Refseq: NM_172117
• Protein Refseq: NP_742115
• UniProt ID: Q3U0P5