Active Recombinant Mouse Dkk1 Protein (243 aa)
Cat.No. : | Dkk1-293D |
Product Overview : | Recombinant Mouse Dickkopf-related protein 1 produced in CHO cells is a polypeptide chain containing 243 amino acids. A fully biologically active molecule, rmDKK-1 has a molecular mass of 19~20 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Protein Length : | 243 |
Description : | Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbate in vitro. DKK-1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK-1 not only functions in head formation during development, but also regulates joint remodeling and bone formation indicating its potential role in the pathogenesis of rheumatoid arthritis and multiple myeloma. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 6 μg/mL, measured in stimulation of alkaline phosphatase activity using CCl-226 cells. |
Molecular Mass : | 19-20 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Mouse Dickkopf-related protein 1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse Dickkopf-related protein 1 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Dkk1 dickkopf homolog 1 (Xenopus laevis) [ Mus musculus ] |
Official Symbol | Dkk1 |
Synonyms | DKK1; dickkopf homolog 1 (Xenopus laevis); dickkopf-related protein 1; dkk-1; dickkopf-1; mdkk-1; |
Gene ID | 13380 |
mRNA Refseq | NM_010051 |
Protein Refseq | NP_034181 |
UniProt ID | O54908 |
◆ Recombinant Proteins | ||
DKK1-2062H | Recombinant Human DKK1 Protein (Thr32-His266), N-8×His tagged | +Inquiry |
DKK1-27610TH | Recombinant Human DKK1, His-tagged | +Inquiry |
DKK1-490HB | Recombinant Human DKK1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
DKK1-907H | Recombinant Human DKK1 protein, His-Avi-tagged | +Inquiry |
Dkk1-15M | Recombinant Mouse Dkk1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK1-2622RCL | Recombinant Rhesus DKK1 cell lysate | +Inquiry |
DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Dkk1 Products
Required fields are marked with *
My Review for All Dkk1 Products
Required fields are marked with *
0
Inquiry Basket