Active Recombinant Mouse Dhfr Protein, His-tagged

• Cat.No.: Dhfr-7193M
• Product Overview: Recombinant mouse DHFR protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-187
• Description: Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. Binds its own mRNA and that of DHFRL1.
• Form: Liquid
• Bio-activity: > 0.2 units/mg, in which one unit will convert 1.0 μmole of 7,8-dihydrofloate and beta-NADPH to 5,6,7,8-tetrahydrofloate and beta-NADP per min at pH 6.5 at 25 centigrade.
  Activity Assay:
  1. Prepare a 1.55 mL assay buffer. The final concentrations are 50 mM potassium phosphate, 0.072 mM dihydrofolic acid, 0.1 mM beta-nicotinamide dinucleotide phosphate and 0.003 % (w/v) bovine serum albumin.
  2. Add 50 μL of recombinant DHFR protein in various concentrations (2 μg, 5 μg) in assay buffer.
  3. Mix by inversion and record the decrease at A340 nm for 5 minutes.
• Molecular Mass: 23.8 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKFEVYEKKD
• Purity: > 95 %
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol, 2 mM DTT, 0.1 M NaCl

Gene Information

• Gene Name: Dhfr dihydrofolate reductase [ Mus musculus (house mouse) ]
• Official Symbol: Dhfr
• Synonyms: Dhfr; dihydrofolate reductase; AA607882; AI662710; AW555094; 8430436I03Rik; dihydrofolate reductase; EC 1.5.1.3
• Gene ID: 13361
• mRNA Refseq: NM_010049
• Protein Refseq: NP_034179
• UniProt ID: P00375