Active Recombinant Mouse Defb2 Protein (51 aa)

• Cat.No.: Defb2-036D
• Product Overview: Recombinant Mouse Defb2 Protein without tag was expressed in E. coli.

Specification

• Description: Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins are distinguished from the β-defensins by the pairing of their three disulfide bonds. To date, four β-defensins have been identified; BD-1, BD-2, BD-3 and BD-4. β-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they are chemoattractant towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal sequence and, in the case of BD-1 (36 a.a.), a propeptide region. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds.
• Source: E. coli
• Species: Mouse
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Determined Sterile Filtered White lyophilized (freeze-dried) powder.by its ability to chemoattract immature human dendritic cells using a concentration of 10.0-100.0 ng/mL.
• Molecular Mass: Approximately 5.54 kDa, a single non-glycosylated polypeptide chain containing 51 amino acids.
• Protein length: 51
• AA Sequence: AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK
• Endotoxin: Less than 1 EU/mg of rMuBD-2 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Defb2 defensin beta 2 [ Mus musculus (house mouse) ]
• Official Symbol: Defb2
• Synonyms: Defb2; defensin beta 2; BD-2; beta-defensin 2
• Gene ID: 13215
• mRNA Refseq: NM_010030
• Protein Refseq: NP_034160
• UniProt ID: P82020