Active Recombinant Mouse Cxcl15 Protein

• Cat.No.: Cxcl15-136M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 15 (Cxcl15) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions.
• Bio-activity: Determined by its ability to chemoattract human neutrophils using a concentration range of 20.0-100.0 ng/ml.
• Molecular Mass: 16.3 kDa
• AA Sequence: QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Cxcl15 chemokine (C-X-C motif) ligand 15 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl15
• Synonyms: Cxcl15; chemokine (C-X-C motif) ligand 15; Il8; weche; Scyb15; lungkine; C-X-C motif chemokine 15; interleukin 8; small inducible cytokine subfamily B, member 15; small-inducible cytokine B15
• Gene ID: 20309
• mRNA Refseq: NM_011339
• Protein Refseq: NP_035469
• UniProt ID: Q9WVL7