Active Recombinant Mouse Ctla4 Protein, hIgG/His-tagged
Cat.No. : | Ctla4-06M |
Product Overview : | Recombinant mouse Ctla-4 (38-161aa), fused to hIgG-His-tag at C terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | Fc&His |
Protein Length : | 38-161 a.a. |
Description : | This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | Liquid |
Bio-activity : | The activity is determined by the IL-2 ELISA in a using stimulated Jurkat human acute T cell leukemia cells with Human B7-1/CD80. The ED50 range ≤ 150 ng/mL. |
Molecular Mass : | 40.6 kDa (363aa) |
AA Sequence : | IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus (house mouse) ] |
Official Symbol | Ctla4 |
Synonyms | Ctla4; cytotoxic T-lymphocyte-associated protein 4; Cd152; Ly-56; Ctla-4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4 |
Gene ID | 12477 |
mRNA Refseq | NM_009843 |
Protein Refseq | NP_033973 |
UniProt ID | P09793 |
◆ Recombinant Proteins | ||
Ctla4-3845G | Recombinant Guinea pig Ctla4 Protein (Ala37-Asp161), C-His tagged | +Inquiry |
RFL2295MF | Recombinant Full Length Mouse Cytotoxic T-Lymphocyte Protein 4(Ctla4) Protein, His-Tagged | +Inquiry |
CTLA4-354C | Active Recombinant Cynomolgus/Rhesus CTLA4 protein, His-tagged | +Inquiry |
CTLA4-7259H | Recombinant Human CTLA4, His-tagged | +Inquiry |
CTLA4-648C | Recombinant Cynomolgus monkey CTLA4 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ctla4 Products
Required fields are marked with *
My Review for All Ctla4 Products
Required fields are marked with *
0
Inquiry Basket