Active Recombinant Mouse CSF3 Protein

• Cat.No.: CSF3-50M
• Product Overview: Recombinant Mouse CSF3 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Granulocyte-colony stimulating factor (G-CSF) is a cytokine that functions as a potent inducer of neutrophilic granulocyte proliferation, terminal differentiation, and activation. G-CSF synthesis occurs in monocyte, macrophage, epithelial, endothelial, and fibroblast cells after activation by bacterial endotoxins, tumor necrosis factor alpha (TNFα), interleukin 1 (IL-1), or interleukin 17 (IL-17). The functional activity of G-CSF is mediated through the granulocyte colony-stimulating factor receptor (G-CSF-R) to activate JAK/STAT and MAPK signal transduction pathways. G-CSF also promotes neurogenesis and inhibits neuronal apoptosis. Human and mouse G-CSF proteins are cross-reactive.
• Bio-activity: NFS-60 cell proliferation, ≤50 pg/mL
• Molecular Mass: Monomer, 19.1 kDa (179 aa)
• AA Sequence: MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium citrate, pH 3.0
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Csf3 colony stimulating factor 3 (granulocyte) [ Mus musculus (house mouse) ]
• Official Symbol: CSF3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; Csfg; G-CSF; MGI-IG
• Gene ID: 12985
• mRNA Refseq: NM_009971
• Protein Refseq: NP_034101
• UniProt ID: P09920