Active Recombinant Mouse Chst5 Protein, His-tagged

• Cat.No.: Chst5-06M
• Product Overview: Recombinant mouse CHST5 (27-395aa), fused to His-tag at C terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 27-395 a.a.
• Description: The protein encoded by this gene belongs to the Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST) family, members of which catalyze the transfer of sulfate to position 6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) residues within proteoglycans, and sulfation of O-linked sugars of mucin-type acceptors. Carbohydrate sulfation plays a critical role in many biologic processes. This gene is predominantly expressed in colon and small intestine.
• Form: Liquid
• Bio-activity: Specific activity is > 10,000 pmol/min/μg, and is defined as the amount of enzyme that sulfate from PAPS to N-acetyl-D-glucosamine per minute at pH 7.5, at 37 centigrade.
• Molecular Mass: 42.9kDa (380aa)
• AA Sequence: SRQVPSSPAGLGERVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWDTLSQGSAPALHMAVRDLIRSVFLCDMDVFDAYLPWRRNISDLFQWAVSRALCSPPVCEAFARGNISSEEVCKPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPRLRVVNEVCRSHVRIAEAALHKPPPFLQDRYRLVRYEDLARDPLTVIRELYAFTGLGLTPQLQTWIHNITHGSGPGARREAFKTTSRDALSVSQAWRHTLPFAKIRRVQELCGGALQLLGYRSVHSELEQRDLSLDLLLPRGMDSFKWASSTEKQPES
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Enzyme Activity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol

Gene Information

• Gene Name: Chst5 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 [ Mus musculus (house mouse) ]
• Official Symbol: Chst5
• Synonyms: Chst5; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5; GST-; GST-4; I-GlcN; Gn6st-3; AI173964; I-GlcNAc-6-ST; carbohydrate sulfotransferase 5; GST4; I-GlcNAc6ST; N-acetylglucosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4; glcNAc6ST-3; intestinal GlcNAc-6-sulfotransferase; intestinal N-acetylglucosamine-6-O-sulfotransferase; mIGn6ST; EC 2.8.2.-
• Gene ID: 56773
• mRNA Refseq: NM_019950
• Protein Refseq: NP_064334
• UniProt ID: Q9QUP4