Active Recombinant Mouse Ccl22 Protein

• Cat.No.: Ccl22-131M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-C motif) ligand 22 (Ccl22) without tag was expressed in E.coli.

Specification

• Description: Chemotactic for activated T-lymphocytes. May play an important role in the collaboration of dendritic cells and B-lymphocytes with T-cells in immune responses.
• Source: E. coli
• Species: Mouse
• Bio-activity: Determined by its ability to chemoattract human activated lymphocytes using a concentration of 10.0-100.0 ng/ml.
• Molecular Mass: 7.8 kDa
• AA Sequence: GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ccl22 chemokine (C-C motif) ligand 22 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl22
• Synonyms: Ccl22; chemokine (C-C motif) ligand 22; MDC; DCBCK; ABCD-1; Scya22; C-C motif chemokine 22; CC chemokine ABCD-1; SMALL INDUCIBLE CYTOKINE A22 PRECURSOR (CC CHEMOKINE ABCD-1) (ACTIVATED B AND DENDRITIC CELL-DERIVED); activated B and dendritic cell-derived; dendritic cell and B cell derived chemokine; small inducible cytokine subfamily A, member 22; small inducible cytokine subfamily A22; small-inducible cytokine A22
• Gene ID: 20299
• mRNA Refseq: NM_009137
• Protein Refseq: NP_033163
• UniProt ID: O88430