Active Recombinant Mouse Ccl2 Protein

• Cat.No.: Ccl2-130M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-C motif) ligand 2 (Ccl2) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis.
• Bio-activity: Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 1.0-20.0 ng/ml.
• Molecular Mass: 13.8 kDa
• AA Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ccl2 chemokine (C-C motif) ligand 2 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl2
• Synonyms: Ccl2; chemokine (C-C motif) ligand 2; JE; HC11; MCAF; MCP1; MCP-1; Scya2; Sigje; SMC-CF; AI323594; C-C motif chemokine 2; monocyte chemoattractant protein 1; monocyte chemotactic protein 1; platelet-derived growth factor-inducible protein JE; small-inducible cytokine A2
• Gene ID: 20296
• mRNA Refseq: NM_011333
• Protein Refseq: NP_035463
• UniProt ID: P10148