Active Recombinant Mouse Btc Protein

• Cat.No.: Btc-037M
• Product Overview: Purified recombinant protein of Mouse betacellulin, epidermal growth factor family member (Btc) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes a member of the epidermal growth factor (EGF) family. These growth factors are ligands for the EGFR/ErbB receptor tyrosine kinases, and play roles in cell growth and differentiation. The encoded protein is synthesized as a transmembrane precursor that is proteolytically cleaved to generate a mature peptide, and plays a role in the differentiation of pancreatic beta cells. This gene may also play a protective role in acute pancreatitis, whereas increased expression of this gene may contribute to diabetic macular edema. Gene therapy using combinations of this gene and other pancreas-specific transcription factors may induce islet neogenesis and remediate hyperglycemia in type 1 diabetes.
• Bio-activity: Determined by its ability to stimulate the proliferation of mouse Balb/3T3 cells. The expected ED50 is less than or equal to 0.01 ng/ml, corresponding to a specific activity of > 1 x 10^8 units/mg.
• Molecular Mass: 9 kDa
• AA Sequence: DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Btc betacellulin, epidermal growth factor family member [ Mus musculus (house mouse) ]
• Official Symbol: Btc
• Synonyms: Btc; betacellulin, epidermal growth factor family member; Bcn; betacellulin; probetacellulin
• Gene ID: 12223
• mRNA Refseq: NM_007568
• Protein Refseq: NP_031594
• UniProt ID: Q05928