Active Recombinant Mouse Btc Protein
Cat.No. : | Btc-037M |
Product Overview : | Purified recombinant protein of Mouse betacellulin, epidermal growth factor family member (Btc) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a member of the epidermal growth factor (EGF) family. These growth factors are ligands for the EGFR/ErbB receptor tyrosine kinases, and play roles in cell growth and differentiation. The encoded protein is synthesized as a transmembrane precursor that is proteolytically cleaved to generate a mature peptide, and plays a role in the differentiation of pancreatic beta cells. This gene may also play a protective role in acute pancreatitis, whereas increased expression of this gene may contribute to diabetic macular edema. Gene therapy using combinations of this gene and other pancreas-specific transcription factors may induce islet neogenesis and remediate hyperglycemia in type 1 diabetes. |
Bio-activity : | Determined by its ability to stimulate the proliferation of mouse Balb/3T3 cells. The expected ED50 is less than or equal to 0.01 ng/ml, corresponding to a specific activity of > 1 x 10^8 units/mg. |
Molecular Mass : | 9 kDa |
AA Sequence : | DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Btc betacellulin, epidermal growth factor family member [ Mus musculus (house mouse) ] |
Official Symbol | Btc |
Synonyms | Btc; betacellulin, epidermal growth factor family member; Bcn; betacellulin; probetacellulin |
Gene ID | 12223 |
mRNA Refseq | NM_007568 |
Protein Refseq | NP_031594 |
UniProt ID | Q05928 |
◆ Recombinant Proteins | ||
Btc-330R | Recombinant Rat Btc Protein, His-tagged | +Inquiry |
BTC-320B | Active Recombinant Bovine Betacellulin | +Inquiry |
BTC-268H | Recombinant Human BTC, LEVLFQ tagged | +Inquiry |
BTC-10315H | Recombinant Human BTC, GST-tagged | +Inquiry |
BTC-1378H | Recombinant Human BTC Protein (Asp32-Tyr111), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Btc Products
Required fields are marked with *
My Review for All Btc Products
Required fields are marked with *
0
Inquiry Basket