Active Recombinant Mouse BAFF Protein, His-Tagged
Cat.No. : | BAFF-01M |
Product Overview : | Recombinant mouse BAFF Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | B-cell activating factor (BAFF) also known as tumor necrosis factor ligand superfamily member 13B is a protein, that in humans, is encoded by the TNFSF13B gene. BAFF is also known as B Lymphocyte Stimulator (BLyS) and TNF- and APOL-related leukocyte expressed ligand (TALL-1) and the Dendritic cell-derived TNF-like molecule. BAFF is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. |
Form : | Lyophilized powder |
AA Sequence : | MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFF IYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in mouse B cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 10^6 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Tnfsf13b tumor necrosis factor (ligand) superfamily, member 13b [ Mus musculus (house mouse) ] |
Official Symbol | BAFF |
Synonyms | BAFF; BLyS; TALL1; THANK; zTNF4; TALL-1; Tnlg7a; TNFSF20; D8Ertd387e |
Gene ID | 24099 |
mRNA Refseq | NM_001347309.1 |
Protein Refseq | NP_001334238.1 |
UniProt ID | Q9WU72 |
◆ Recombinant Proteins | ||
BAFF-42B | Recombinant Bovine BAFF (TNFSF13B) | +Inquiry |
BAFF-53S | Recombinant Swine BAFF (TNFSF13B) | +Inquiry |
BAFF-01M | Active Recombinant Mouse BAFF Protein, His-Tagged | +Inquiry |
BAFF-91E | Recombinant Equine BAFF | +Inquiry |
BAFF-61C | Recombinant Chicken BAFF (TNFSF13B) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAFF Products
Required fields are marked with *
My Review for All BAFF Products
Required fields are marked with *
0
Inquiry Basket