Active Recombinant Mouse Acvr2a Protein, mFc tagged

• Cat.No.: Acvr2a-01M
• Product Overview: Recombinant Mouse Acvr2a Protein with mFc tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: mFc
• Protein Length: 21-134aa
• Description: Enables several functions, including BMP receptor activity; PDZ domain binding activity; and activin binding activity. Acts upstream of or within several processes, including Sertoli cell proliferation; copulation; and embryonic skeletal system development. Located in cell surface. Is expressed in several structures, including central nervous system; early conceptus; gonad; gut; and sensory organ. Used to study Weissenbacher-Zweymuller syndrome. Human ortholog(s) of this gene implicated in colon cancer. Orthologous to human ACVR2A (activin A receptor type 2A).
• Bio-activity: The ED50 is 0.1689 ng/mL in the presence of 3 ng/mL recombinant Activin. The activity was measured by its ability to neutralize Activin-mediated inhibition on K562 cell proliferation.
• Molecular Mass: The protein has a calculated MW of 40 kDa.
• AA Sequence: ILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
• Endotoxin: < 0.1 EU/μg
• Purity: < 95% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 6.92 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH 7.4

Gene Information

• Gene Name: Acvr2a activin receptor IIA [ Mus musculus (house mouse) ]
• Official Symbol: Acvr2a
• Synonyms: ACVR2A; activin receptor IIA; activin receptor type-2A; ACTR-IIA; activin receptor type IIA; Acvr2; ActrIIa; TactrII
• Gene ID: 11480
• mRNA Refseq: NM_007396
• Protein Refseq: NP_031422
• UniProt ID: P27038