Active Recombinant Mouse 4-1BB Protein, His-Tagged

• Cat.No.: 4-1BB-01M
• Product Overview: Recombinant mouse 4-1BB Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: 4-1BB Ligand Human Recombinant protein. 4-1BBL is a transmembrane cytokine that is part of the tumor necrosis factor (TNF) ligand family. Recombinant human 4-1BB ligand is intended for use in cell culture applications. 4-1BBL and its interaction with 4-1BB is involved in the antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells.
• Form: Lyophilized powder
• AA Sequence: MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVD
  SPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAY
  RDWELSYPNTTSFGLFLVKPDNPWE with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <0.05 μg/mL.
• Purity: >95% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.