Active Recombinant Human VEGFD Protein

• Cat.No.: VEGFD-198V
• Product Overview: Recombinant Human VEGFD Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Vascular Endothelial Growth Factor (VEGF)-D, also known as c-Fos-induced growth factor (FIGF), is a member of the PDGF/VEGF growth factor family. It is expressed highly in lung, heart and small intestine, and at lower levels in skeletal muscle, colon and pancreas. It binds to VEGFR-2 and VEGFR-3 receptors and activates downstream signals. VEGF-D is a growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth. It is involved in many developmental and physiological processes including the formation of venous and lymphatic vascular systems during embryogenesis and the maintenance of differentiated lymphatic endothelium in adults. In tumor pathology, it has been reported to play a role in restructuring of lymphatic channels and regional lymph node metastasis.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 μg/mL, measured in a cell proliferation assay using HUVEC cells.
• Molecular Mass: 18-19 kDa, observed by reducing SDS-PAGE.
• AA Sequence: FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Human VEGF-D remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human VEGF-D should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: VEGFD vascular endothelial growth factor D [ Homo sapiens (human) ]
• Official Symbol: VEGFD
• Synonyms: VEGFD; vascular endothelial growth factor D; FIGF; VEGF-D; vascular endothelial growth factor D; c-fos induced growth factor (vascular endothelial growth factor D)
• Gene ID: 2277
• mRNA Refseq: NM_004469
• Protein Refseq: NP_004460
• MIM: 300091
• UniProt ID: O43915