Active Recombinant Human VEGF165 Protein (165 aa)

• Cat.No.: VEGFA-144V
• Product Overview: Recombinant Human VEGF165 Protein (165 aa) without tag was expressed in P. pastoris.

Specification

• Species: Human
• Source: P.pastoris
• Protein Length: 165
• Description: Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 of 1-5 ng/mL, measured by the dose-dependent stimulation of the proliferation of HUVEC cells, corresponding to a specific activity of 2 × 10^5 to 1 × 10^6 units/mg.
• Molecular Mass: 38.2kDa, observed by non-reducing SDS-PAGE
• AA Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Endotoxin: < 0.5 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by reducing SDS-PAGE.
• Storage: Lyophilized recombinant human Vascular Endothelial Growth Factor A165 (rhVEGF-A165) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhVEGF-A165 should be stable up to 4 week at 4 centigrade or up to 6 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 25 mM HEPES and 150 mM NaCl, pH 7.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens ]
• Official Symbol: VEGFA
• Synonyms: VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor, VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609
• Gene ID: 7422
• mRNA Refseq: NM_001025366
• Protein Refseq: NP_001020537
• MIM: 192240
• UniProt ID: P15692