Active Recombinant Human TOP1, His-tagged
Cat.No. : | TOP1-3745H |
Product Overview : | Recombinant human topoisomerase I produced in Sf9 cells is a single polypeptide chain with a 6His tag at the N-terminus. It contains 779 (15+764) amino acids having a predicted molecular mass of approximately 92.5kD, but migrates in SDS-PAGE with an apparent molecular mass of 105kD. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Description : | This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. |
Form : | 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA |
Bio-activity : | DNA Topoisomerase I catalyzes the latering the topology of DNA during transcription and replication. Recombinant Topo I protein is ideal for the studies of DNA topology and other related function assays. |
AA Sequence : | MHHHHHHGRRASVEFSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIK PLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWE EERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKD WRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFK IEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIM LNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADT VGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNK HLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQ TKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLN YLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF |
Purity : | ≥90%, as determined by SDS-PAGE |
Usage : | FOR RESEARCH ONLY |
Storage : | The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles. |
Gene Name | TOP1 topoisomerase (DNA) I [ Homo sapiens ] |
Official Symbol | TOP1 |
Synonyms | TOPI; DNA topoisomerase 1; type I DNA topoisomerase |
Gene ID | 7150 |
mRNA Refseq | NM_003286 |
Protein Refseq | NP_003277 |
MIM | 126420 |
UniProt ID | P11387 |
Chromosome Location | 20q12-q13.1 |
Pathway | Caspase cascade in apoptosis, organism-specific biosystem; Integrated Pancreatic Cancer Pathway, organism-specific biosystem |
◆ Recombinant Proteins | ||
PLXDC1-1712H | Recombinant Human PLXDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARF6-9803H | Recombinant Human ARF, His-tagged | +Inquiry |
ATP1A3-1088HF | Recombinant Full Length Human ATP1A3 Protein, GST-tagged | +Inquiry |
NI36-RS06650-0924S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS06650 protein, His-tagged | +Inquiry |
KRT2-3317R | Recombinant Rat KRT2 Protein | +Inquiry |
◆ Native Proteins | ||
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
SNCB-27206TH | Native Human SNCB | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
PTI-603B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBA-2078MCL | Recombinant Mouse INHBA cell lysate | +Inquiry |
CSN1S1-411HCL | Recombinant Human CSN1S1 cell lysate | +Inquiry |
DUSP5-6772HCL | Recombinant Human DUSP5 293 Cell Lysate | +Inquiry |
ZRSR2-9189HCL | Recombinant Human ZRSR2 293 Cell Lysate | +Inquiry |
SpinalCord-576M | MiniPig Spinal Cord Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOP1 Products
Required fields are marked with *
My Review for All TOP1 Products
Required fields are marked with *
0
Inquiry Basket