Recombinant Human TNFRSF18 protein, GST-tagged
Cat.No. : | TNFRSF18-301498H |
Product Overview : | Recombinant Human TNFRSF18 (26-130 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Gln26-Pro130 |
AA Sequence : | QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TNFRSF18 tumor necrosis factor receptor superfamily, member 18 [ Homo sapiens ] |
Official Symbol | TNFRSF18 |
Synonyms | TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; AITR; CD357; GITR; activation-inducible TNFR family receptor; glucocorticoid-induced TNFR-related protein; TNF receptor superfamily activation-inducible protein; GITR-D; |
Gene ID | 8784 |
mRNA Refseq | NM_004195 |
Protein Refseq | NP_004186 |
MIM | 603905 |
UniProt ID | Q9Y5U5 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TNFRSF18 Products
Required fields are marked with *
My Review for All TNFRSF18 Products
Required fields are marked with *
0
Inquiry Basket