Active Recombinant Human TNFRSF14 Protein, Fc-tagged
Cat.No. : | TNFRSF14-878H |
Product Overview : | Recombinant Human TNFRSF14 fused with Fc tag at C-terminal was expressed in Hi-5 Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Hi-5 Insect Cells |
Tag : | Fc |
Description : | This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Bio-activity : | Determined by its ability to neutralize 0.25 ng/ml of hTNFβ induced cytotoxicity on murine L929 cells. The expected ED50 for this effect is 1.3-1.9 ug/mL of HVEM-Fc. |
Molecular Mass : | 41 kDa |
AA Sequence : | LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | TNFRSF14 tumor necrosis factor receptor superfamily, member 14 [ Homo sapiens ] |
Official Symbol | TNFRSF14 |
Synonyms | TNFRSF14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor superfamily member 14; ATAR; CD270; herpesvirus entry mediator; HVEA; HVEM; LIGHTR; TR2; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; |
Gene ID | 8764 |
mRNA Refseq | NM_003820 |
Protein Refseq | NP_003811 |
MIM | 602746 |
UniProt ID | Q92956 |
◆ Recombinant Proteins | ||
Tnfrsf14-428MAF488 | Recombinant Mouse Tnfrsf14 Protein, His-Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
HVEM-3271H | Recombinant Human HVEM protein(Met1-Val202), His-tagged, Biotinylated | +Inquiry |
TNFRSF14-878H | Active Recombinant Human TNFRSF14 Protein, Fc-tagged | +Inquiry |
Tnfrsf14-869M | Active Recombinant Mouse Tnfrsf14 Protein, Fc Chimera | +Inquiry |
TNFRSF14-75CF | Recombinant Monkey TNFRSF14 Protein, Fc-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2420MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2155HCL | Recombinant Human TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF14 Products
Required fields are marked with *
My Review for All TNFRSF14 Products
Required fields are marked with *
0
Inquiry Basket