Active Recombinant Human TNFRSF13C, Fc Chimera

Cat.No. : TNFRSF13C-491H
Product Overview : Recombinant Human tumor necrosis factor receptor encoding the signal peptide of human GH receptor was fused to the extracellular domain of human tumor necrosis factor receptor (aa 2-73), which was in turn fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 2-73 a.a.
Description : BAFF receptor (B cell activating factor receptor) is a 19 kD type III membrane protein that is a member of the TNF receptor superfamily. The primary responsibility for BAFF R is the mediating role of BAFF in B-cell survival and maturation. BAFF R is one of three different receptors (also includes TACI and BCMA) specific for BAFF and plays a predominant role in BAFF induced B-cell development and survival.
Amino Acid Sequence : SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass : Tumor necrosis factor receptor Chimera migrates as two bands at 35 and 38-46 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified tumor necrosis factor receptor that has a predicted molecular mass of 34 kDa.
pI : Due to post-translational modifications Symansis tumor necrosis factor receptor Chimera separates into a number of glycoforms with a pI between 5 and 9.5 on 2D PAGE. This compares with the unmodified BAFF R - Fc Chimera that has a predicted pI of 8.4.
% Carbohydrate : Purified BAFF R - Fc Chimera consists of approximately 0-25% carbohydrate by weight.
Glycosylation : BAFF R – Fc Chimera is N- and O-glycosylated.
Purity : >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : The ED50of BAFF R – Fc Chimera is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line.
Gene Name TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens ]
Synonyms TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; BAFFR; CD268; BAFF-R; MGC138235; OTTHUMP000000 28746; B cell-activating factor receptor; BLyS receptor 3; BAFF receptor
Gene ID 115650
mRNA Refseq NM_052945
Protein Refseq NP_443177
UniProt ID Q96RJ3
Chromosome Location 22q13.1-q13.3
MIM 606269
Pathway Cytokine-cytokine receptor interaction; Primary immunodeficiency
Function receptor activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNFRSF13C Products

Required fields are marked with *

My Review for All TNFRSF13C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon