Active Recombinant Human TNFRSF13C, Fc Chimera

• Cat.No.: TNFRSF13C-491H
• Product Overview: Recombinant Human tumor necrosis factor receptor encoding the signal peptide of human GH receptor was fused to the extracellular domain of human tumor necrosis factor receptor (aa 2-73), which was in turn fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• ProteinLength: 2-73 a.a.
• Description: BAFF receptor (B cell activating factor receptor) is a 19 kD type III membrane protein that is a member of the TNF receptor superfamily. The primary responsibility for BAFF R is the mediating role of BAFF in B-cell survival and maturation. BAFF R is one of three different receptors (also includes TACI and BCMA) specific for BAFF and plays a predominant role in BAFF induced B-cell development and survival.
• Amino Acid Sequence: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
• Molecular Mass: Tumor necrosis factor receptor Chimera migrates as two bands at 35 and 38-46 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified tumor necrosis factor receptor that has a predicted molecular mass of 34 kDa.
• pI: Due to post-translational modifications Symansis tumor necrosis factor receptor Chimera separates into a number of glycoforms with a pI between 5 and 9.5 on 2D PAGE. This compares with the unmodified BAFF R - Fc Chimera that has a predicted pI of 8.4.
• % Carbohydrate: Purified BAFF R - Fc Chimera consists of approximately 0-25% carbohydrate by weight.
• Glycosylation: BAFF R – Fc Chimera is N- and O-glycosylated.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
• Activity: The ED₅₀of BAFF R – Fc Chimera is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line.

Gene Information

• Gene Name: TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens ]
• Synonyms: TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; BAFFR; CD268; BAFF-R; MGC138235; OTTHUMP000000 28746; B cell-activating factor receptor; BLyS receptor 3; BAFF receptor
• Gene ID: 115650
• mRNA Refseq: NM_052945
• Protein Refseq: NP_443177
• UniProt ID: Q96RJ3
• Chromosome Location: 22q13.1-q13.3
• MIM: 606269
• Pathway: Cytokine-cytokine receptor interaction; Primary immunodeficiency
• Function: receptor activity