Active Recombinant Human TGFB2

• Cat.No.: TGFB2-540H
• Product Overview: A 27.08 KDa recombinant protein composed of two identical 118 amino acid peptide chains linked by a single disulfide bond, produced by transient expression in non-transgenic plants (Nicotiana benthamiana), and have a 6-His-tag at the N-terminal end.

Specification

• Species: Human
• Source: Human
• Tag: His
• Description: Transforming growth factor-beta 2 (TGF-μ2) is a secreted protein known as a cytokine that performs many cellular functions and has a vital role during embryonic development (alternative names: Glioblastoma-derived T-cell suppressor factor, G-TSF, BSC-1 cell growth inhibitor, Polyergin, Cetermin). It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. There are two named isoforms of this protein, created by alternative splicing of the same gene.
• Sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
• Theoretical MW (kDa): 27.08
• Form: Lyophilized
• Preparation Method: Non-transgenic plants (Nicotiana benthamiana) expression system
• Purity: > 97% by SDS-PAGE
• Endotoxin Level: μ 0.04 EU/ug protein
• Activity: The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation.
• Application: SDS-PAGE; Western Blot (Recombinant protein)
• Storage Buffer: Lyophilized from 0.05 M Tris-HCl, pH 7.4.
• Storage: Store at 4°C on dry atmosphere.
• Unitprot ID: P61812
• Pathways: Cell cycle; Chronic myeloid leukemia; Cytokine-cytokine receptor interaction; Dilated cardiomyopathy; Hypertrophic cardiomyopathy (HCM); MAPK signaling pathway; Pathways in cancer; Renal cell carcinoma; TGF-beta signaling pathway; Hemostasis

Gene Information

• Gene Name: TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
• Official Symbol: TGFB2
• Synonyms: TGFB2; Transforming growth factor beta 2; MGC116892; TGF-beta2; Transforming growth factor beta-2; TGF-beta-2; Glioblastoma-derived T-cell suppressor factor; G-TSF; BSC-1 cell growth inhibitor; Polyergin; Cetermin
• Gene ID: 7042
• mRNA Refseq: NM_001135599
• Protein Refseq: NP_001129071
• MIM: 190220
• Chromosome Location: 1q41
• Function: beta-amyloid binding; cytokine activity; protein heterodimerization activity; growth factor activity; type II transforming growth factor beta receptor binding; receptor signaling protein serine/threonine kinase activity