Active Recombinant Human TFPI2, Animal Free

Cat.No. : TFPI2-129H
Product Overview : Recombinant human TFPI-2 domain 1, is a 9.3 kDa protein containing 79 amino acids residues. Human recombinant protein expressed in Nicotiana benthamiana. Recombinant AGV212contains a 6-His-tag at the N-terminal end, is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. Animal free product.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : Non
Description : Recombinant human TFPI-2 domain 1 or AGV 212 is a protease inhibitor peptide generated from the first Kunitz domain of the human Tissue Factor Protein Inhibitor 2 (TFPI-2) protein, after site-directed mutagenesis to increase its activity. It is arranged in a single polypeptide chain that is linked by three disulphide bridges. AGV 212 is quite stable and inhibits trypsin with high efficiency and Ki lower than TFPI-2 one. TFPI-2 has been shown to inhibit Endothelial Cell Matrix (ECM) proteases essential for angiogenesis and metastasis.
Form : Lyophilized powder containing phosphate buffer salts, pH 7.1.
Bio-activity : The activity of the inhibitor is expressed as the amount of trypsin inhibited per milligram of inhibitor. The ability to prevent the hydrolysis of benzoyl-L-arginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. One mg protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein.
Molecular Mass : Recombinant human TFPI-2 domain 1, is a 9.3 kDa protein containing 79 amino acids residues.
AA Sequence : HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEK VPKV
Endotoxin : < 0.04="" eu="" ug="" protein="" (lal="">
Purity : >97% by SDS-PAGE gel
Applications : Trypsin inhibitor, Western blot, Immunogen
Storage : This lyophilized preparation is stable at 2-8°C, but should be kept at –20°C for long term storage. Diluted solutions are less stable than concentrated ones. Repeated freezing and thawing is not recommended.
Reconstitution : Lyophilized protein should be reconstituted adding 1 ml of sterile water to the vial, which gives a concentration of 1 mg of protease inhibitor per ml. At higher concentration the solubility may be reduced and multimers generated. Soluble in water and in aqueous buffers of low ionic strengths. Repeated freeze-thaw cycles should be avoided. Optimal reconstitution please follow batch Quality Control sheet instructions.
Gene Name TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens ]
Official Symbol TFPI2
Synonyms TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI 2; placental protein 5; TFPI-2; FLJ21164;
Gene ID 7980
mRNA Refseq NM_006528
Protein Refseq NP_006519
MIM 600033
UniProt ID P48307
Chromosome Location 7q
Function extracellular matrix structural constituent; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TFPI2 Products

Required fields are marked with *

My Review for All TFPI2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon