Active Recombinant Human TFF3 Protein (59 aa)

• Cat.No.: TFF3-112T
• Product Overview: Recombinant Human TFF3 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 59
• Description: The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are secreted in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF-3 is expressed by goblet cells and in the uterus, and has also been shown to express in certain cancers, including colorectal, hepatocellular, and in biliary tumors. TFF3 may be useful as a molecular marker for certain types of cancer, but its role, if any, in tumorigenesis is unknown. TFF3 also promotes airway epithelial cell migration and differentiation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1.0-10.0 μg/mL.
• Molecular Mass: Approximately 6.5 kDa, a single non-glycosylated polypeptide chain containing 59 amino acids.
• AA Sequence: EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
• Endotoxin: Less than 1 EU/μg of rHuTFF3 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TFF3 trefoil factor 3 (intestinal) [ Homo sapiens ]
• Official Symbol: TFF3
• Synonyms: TFF3; trefoil factor 3 (intestinal); trefoil factor 3; HITF; ITF; polypeptide P1.B; P1B; TFI
• Gene ID: 7033
• mRNA Refseq: NM_003226
• Protein Refseq: NP_003217
• MIM: 600633
• UniProt ID: Q07654