Active Recombinant Human TEK, Fc-tagged

Cat.No. : TEK-703H
Product Overview : The recombinant human Tie2-Fc fusion is expressed as a 952 amino acid protein consisting of Ala23- Met746 region of Tie2 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Recombinant Tie2 protein binds human Angiopoietin-2 and inhibits Angiopoietin-2 mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 106.3; Estimated by SDS-PAGE under reducing condition (kDa): 110-120
AA Sequence : AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKI NGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEV PDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPP GFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCN NGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTV LHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINI SSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTA SIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVV RARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDV KIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMSTGTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name TEK TEK tyrosine kinase, endothelial [ Homo sapiens ]
Official Symbol TEK
Synonyms TEK; TEK tyrosine kinase, endothelial; venous malformations, multiple cutaneous and mucosal , VMCM; angiopoietin-1 receptor; CD202b; TIE 2; TIE2; VMCM1; hTIE2; p140 TEK; soluble TIE2 variant 1; soluble TIE2 variant 2; endothelial tyrosine kinase; tyrosine-protein kinase receptor TEK; tunica interna endothelial cell kinase; tyrosine-protein kinase receptor TIE-2; tyrosine kinase with Ig and EGF homology domains-2; VMCM; TIE-2; CD202B;
Gene ID 7010
mRNA Refseq NM_000459
Protein Refseq NP_000450
MIM 600221
UniProt ID Q02763
Chromosome Location 9p21
Pathway Angiogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Rheumatoid arthritis, organism-specific biosystem; Rheumatoid arthritis, conserved biosystem; Tie2 Signaling, organism-specific biosystem;
Function ATP binding; nucleotide binding; protein binding; protein kinase activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TEK Products

Required fields are marked with *

My Review for All TEK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon