Active Recombinant Human Sulfite oxidase Mo Centre Domain/SUOX

Cat. No. :	SUOX-191H
Description :	Sulfite oxidase (EC 1.8.3.1) is a homodimeric proteinlocalized in the intermembrane space of mitochondria of all eukaryoticorganisms. Each subunit contains an N-terminal domain, with a heme cofactor,and a C-terminal domain, with a molybdopterin cofactor (MoVI). The enzymecatalyzes the oxidation of sulfite to sulfate, which takes place at themolybdenum centre, and is the final reaction in the oxidative degradation ofthe sulfur amino acids cystein and methionine.
Source :	E. coli
Sequence :	MGSSHHHHHHSSGLVPRGSHMVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP
Unit definition :	One unit of sulfiteoxidase activity is defined as the amount of enzyme required to oxidize 1.0µmol of sulfite to sulfate, per min, in a coupled assay where the hydrogenperoxide formed in the first reaction is reduced by an NADH-peroxidase in thepresence of NADH, at 25 °C and pH 8.5.
Purity :	>95%, asdetermined by SDS-PAGE
Specific activity :	0.5 U/mg
Temperature and pHoptimum :	The optimum pH andtemperature are 8.5 and 25 °C, respectively.
Storage :	Sulfite oxidase should be stored at 4 °C and will remain stableup to 3 years if stored as specified.
Tag :	Non

Gene Name	SUOXsulfite oxidase [Homo sapiens]
Official Symbol	SUOX
Synonyms	sulfite oxidase; EC1.8.3.1; sulfite oxidase, mitochondrial; OTTHUMP00000158619
Gene ID	6821
mRNA Refseq	NM_000456
Protein Refseq	NP_000447
MIM	606887
UniProt ID	P51687
Chromosome Location	12q13.2
Pathway	Sulfur metabolism, organism-specific biosystem;Sulfur metabolism, conserved biosystem; sulfite oxidation IV, conservedbiosystem; superpathway of methionine degradation, conserved biosystem
Function	binding; electron carrier activity; hemebinding; metal ion binding; molybdenum ion binding; molybdopterin cofactorbinding; oxidoreductase activity; sulfite oxidase activity

COA

Cat.No. :	SUOX-191H
Product Overview :	Sulfite oxidase comprises the recombinant molybdenumC-terminal domain of Homo sapiens, purified from a TP1000 Escherichia colistrain.