Active Recombinant Human SSTR2 Full Length Transmembrane protein, His-tagged

Cat.No. : SSTR2-1031H
Product Overview : Recombinant Human SSTR2 protein(P30874)(1-369aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-369aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Bio-activity : ①Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 μg/mL can bind Anti-SSTR2 recombinant antibody, the EC50 is 58.13-81.28 ng/mL.②Blocking experiment on Anti-SSTR2 antibody between Human SSTR2-VLPs protein and CT26/Human SSTR2 Stable Cells by Flow cytometry.
Molecular Mass : 42.5 kDa
AA Sequence : MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SSTR2 Products

Required fields are marked with *

My Review for All SSTR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon