Active Recombinant Human SPARC Protein, Tag Free
Cat.No. : | SPARC-31437TH |
Product Overview : | Recombinant Human SPARC ; 286 amino acids, Predicted MWt 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Protein Length : | 18-303 a.a. |
Description : | Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM) (Bradshaw et al. |
Molecular Weight : | 33.000kDa |
Biological activity : | Determined by its ability to increase alkaline phosphatase activity in differentiating MC3T3 cells using a concentration of 0.5-0.7 μg/ml. |
Form : | Lyophilised:Reconstitute in waterto a concentration of 0.1-1.0 mg/ml |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10mM Sodium phosphate, pH 7.6 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI |
Sequence Similarities : | Belongs to the SPARC family.Contains 1 EF-hand domain.Contains 1 follistatin-like domain.Contains 1 Kazal-like domain. |
Gene Name | SPARC secreted protein, acidic, cysteine-rich (osteonectin) [ Homo sapiens ] |
Official Symbol | SPARC |
Synonyms | SPARC; secreted protein, acidic, cysteine-rich (osteonectin); ON; cysteine rich protein; osteonectin; |
Gene ID | 6678 |
mRNA Refseq | NM_003118 |
Protein Refseq | NP_003109 |
MIM | 182120 |
Uniprot ID | P09486 |
Chromosome Location | 5q31-q33 |
Pathway | Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem; Senescence and Autophagy, organism-specific biosystem; |
Function | calcium ion binding; collagen binding; extracellular matrix binding; protein binding; |
◆ Recombinant Proteins | ||
SPARC-2725H | Recombinant Human SPARC Protein, His-tagged | +Inquiry |
SPARC-5980C | Recombinant Chicken SPARC | +Inquiry |
Sparc-010M | Recombinant Mouse Sparc Protein, His-tagged | +Inquiry |
SPARC-11H | Recombinant Human SPARC | +Inquiry |
SPARC-210H | Recombinant Human SPARC, His-tagged | +Inquiry |
◆ Native Proteins | ||
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
SPARC-30653TH | Native Human SPARC | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPARC-2120MCL | Recombinant Mouse SPARC cell lysate | +Inquiry |
SPARC-2616HCL | Recombinant Human SPARC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPARC Products
Required fields are marked with *
My Review for All SPARC Products
Required fields are marked with *
0
Inquiry Basket