Recombinant Mouse Sparc Protein, His-tagged

• Cat.No.: Sparc-010M
• Product Overview: Recombinant Mouse Sparc Protein (18-302aa) with His tag was expressed in insect cells.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 18-302aa
• Description: Broad expression in subcutaneous fat pad adult (RPKM 1043.9), bladder adult (RPKM 893.4) and 22 other tissues.
• Form: Liquid
• Molecular Mass: 33.3kDa (291aa)
• AA Sequence: APQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI
• Endotoxin: < 1 EU per 1 µg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Sparc secreted acidic cysteine rich glycoprotein [ Mus musculus (house mouse) ]
• Official Symbol: Sparc
• Synonyms: Sparc; secreted acidic cysteine rich glycoprotein; ON; BM-40; SPARC; basement-membrane protein 40; osteonectin; secreted protein acidic and rich in cysteine
• Gene ID: 20692
• mRNA Refseq: NM_009242
• Protein Refseq: NP_033268
• UniProt ID: P07214