Active Recombinant Human SLC3A2, Fc-tagged

• Cat.No.: SLC3A2-588H
• Product Overview: The recombinant human CD98-Fc is expressed as a 648 amino acid protein consisting of Arg110 - Ala529 region of CD98 (UniProt Accession # P08195 - isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
• Bio-activity: Immobilized CD98 protein binds anti-CD98 monoclonal antibody human IgG1 with high affinity (KD< 10="" nm)="" in="" a="" functional="" elisa.="" blocks="" cd98/lat-mediated="" amino="" acid="" transporter="" and="" signaling="">
• Molecular Mass: Calculated molecular mass (kDa): 71.8; Estimated by SDS-PAGE under reducing condition (kDa): 80-90
• AA Sequence: RELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNF GSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASS FLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCS WSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSAN MTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQA SDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAASTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 110-529 a.a.

Gene Information

• Gene Name: SLC3A2 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [ Homo sapiens ]
• Official Symbol: SLC3A2
• Synonyms: SLC3A2; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; MDU1; 4F2 cell-surface antigen heavy chain; 4F2; 4F2 cell surface antigen heavy chain; 4F2 heavy chain; 4F2HC; 4T2HC; antigen defined by monoclonal 4F2; antigen identified by monoclonal antibodies 4F2; TRA1.10; TROP4; and T43; CD98; CD98 heavy chain; CD98HC; heavy chain; lymphocyte activation antigen 4F2 large subunit; monoclonal 44D7; NACAE; antigen defined by monoclonal 4F2, heavy chain; antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43
• Gene ID: 6520
• mRNA Refseq: NM_001012662
• Protein Refseq: NP_001012680
• MIM: 158070
• UniProt ID: P08195
• Chromosome Location: 11q12-q22
• Pathway: Amino acid transport across the plasma membrane, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem
• Function: calcium:sodium antiporter activity; catalytic activity; cation binding; neutral amino acid transmembrane transporter activity; protein binding