Active Recombinant Human SLAMF9, Fc-tagged

• Cat.No.: SLAMF9-692H
• Product Overview: The recombinant human SLAMF9-Fc fusion protein is expressed as a 445-amino acid protein consisting of Arg19 - Phe234 region of SLAMF9 (UniProt accession #Q96A28) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
• Bio-activity: Immobilized SLAMF9 interacts homophilically with SLAMF9 in a functional ELISA and inhibits anti--CD3e antibody induced IL-2 secretion by human T cells
• Molecular Mass: Calculated molecular mass (kDa): 49.6; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
• AA Sequence: RRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEGHPATIMVTNPHYQGQVSFLDPS YSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITVNFESSGEGACSMSLVCSVEKAGMDMT YSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAFGSTGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 19-234 a.a.

Gene Information

• Gene Name: SLAMF9 SLAM family member 9 [ Homo sapiens ]
• Official Symbol: SLAMF9
• Synonyms: CD2F10; CD84H1; SF2001; CD2F-10; CD84-H1
• Gene ID: 89886
• mRNA Refseq: NM_033438.3
• Protein Refseq: NP_254273.2
• MIM: 608589
• UniProt ID: Q96A28
• Chromosome Location: 1q23.2
• Function: receptor activity