Active Recombinant Human SERPINI1 protein, Tag Free
Cat.No. : | SERPINI1-214S |
Product Overview : | Recombinant Human SERPINI1 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Protein Length : | 17-410 a.a. |
Description : | Neuroserpin is an inhibitory serpin that is expressed predominantly in central nervous system. Although the physiological target of neuroserpin is still unclear, cumulative evidence suggest that it plays an important role in controlling proteolytic degradation of extracellular matrix (ECM) during synaptogenesis and the subsequent development of neuronal plasticity. In the adult brain, neuroserpin is secreted from the growth cones of neurons in areas where synaptic changes are associated with learning and memory, i.e. cerebral cortex, hippocampus, and amygdala. The neuroprotective role of neuroserpin has been demonstrated in transgenic mice lacking neuroserpin expression. The deficiency of neuroserpin in these mice was associated with motor neuron disease characterized by axonal degradation. In humans, defects in neuroserpin, caused by point mutations in the neuroserpin gene, underlie a hereditary disorder called the familial encephalopathy with neuroserpin inclusion bodies (FENIB). |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2 μg/mL, measured by the dose-dependent stimulation of the proliferation of rat C6 cells, corresponding to a specific activity of > 500 units/mg. |
Molecular Mass : | 40-45 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Human Neuroserpin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rh_Neuroserpin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | SERPINI1 serpin peptidase inhibitor, clade I (neuroserpin), member 1 [ Homo sapiens ] |
Official Symbol | SERPINI1 |
Synonyms | SERPINI1; serpin peptidase inhibitor, clade I (neuroserpin), member 1; PI12, serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1; neuroserpin; PI-12; serpin I1; peptidase inhibitor 12; serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1; PI12; DKFZp781N13156; |
Gene ID | 5274 |
mRNA Refseq | NM_001122752 |
Protein Refseq | NP_001116224 |
MIM | 602445 |
UniProt ID | Q99574 |
◆ Recombinant Proteins | ||
Serpini1-5518M | Recombinant Mouse Serpini1 protein, Tag Free | +Inquiry |
SERPINI1-5347R | Recombinant Rat SERPINI1 Protein | +Inquiry |
SERPINI1-01H | Active Recombinant Human SERPINI1 Protein, GST-tagged | +Inquiry |
SERPINI1-1670H | Active Recombinant Human SERPINI1 protein, Tag Free | +Inquiry |
SERPINI1-5006R | Recombinant Rat SERPINI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINI1-2566HCL | Recombinant Human SERPINI1 cell lysate | +Inquiry |
SERPINI1-1658MCL | Recombinant Mouse SERPINI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINI1 Products
Required fields are marked with *
My Review for All SERPINI1 Products
Required fields are marked with *
0
Inquiry Basket