Active Recombinant Human RETN Protein, His-tagged

• Cat.No.: RETN-61H
• Product Overview: Recombinant Human RETN protein(Ser17-Pro108), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Ser17-Pro108
• Tag: N-His
• Form: Liquid in sterile PBS, pH8.0, 10% Glycerol, 8% Trehalose.
• Molecular Mass: The protein has a calculated MW of 11 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGSSHHHHHHHHHHSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

Gene Information

• Gene Name: RETN resistin [ Homo sapiens ]
• Official Symbol: RETN
• Synonyms: RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609
• Gene ID: 56729
• mRNA Refseq: NM_001193374
• Protein Refseq: NP_001180303
• MIM: 605565
• UniProt ID: Q9HD89