Active Recombinant Human PF4 Protein

• Cat.No.: PF4-166P
• Product Overview: Recombinant Human PF4 Protein without tag was expressed in HEK 293.

Specification

• Species: Human
• Source: HEK293
• Description: Platelet factor 4, also known as CXCL4, is expressed in megakaryocytes and stored in the α-granules of platelets. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines. Platelet factor 4 can be antiproliferative and antiangiogenic, at least in part via interfering with FGF2 and VEGF heparin binding and thus inhibiting their signaling. However, it can also be proinflammatory and proatherogenic through multiple effects on monocytes, macrophages and endothelial cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 μg/mL, measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R 3T3 mouse fibroblast cells.
• Molecular Mass: ~7.8 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant human platelet factor 4 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human platelet factor 4 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: PF4 platelet factor 4 [ Homo sapiens (human) ]
• Official Symbol: PF4
• Synonyms: PF4; platelet factor 4; PF-4; CXCL4; SCYB4; platelet factor 4; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4; iroplact; oncostatin-A
• Gene ID: 5196
• mRNA Refseq: NM_002619
• Protein Refseq: NP_002610
• MIM: 173460
• UniProt ID: P02776