Active Recombinant Human PDCD1LG2, Fc-tagged, Biotinylated

• Cat.No.: PDCD1LG2-661H
• Product Overview: The recombinant human PD-L2-Fc fusion is expressed as a 429 amino acid protein consisting of Leu20 - Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds to its receptor PD-1 in a functional ELISA. Blocks its ligand PD-L1"s and PD-L2"s binding to its receptor and mediated signaling activity.
• Molecular Mass: Calculated molecular mass 48.2 kDa; estimated by SDS-PAGE under reducing condition ~60 kDa (probably due to glycosylation)
• AA Sequence: LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQ VRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHS RTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 20-220 a.a.

Gene Information

• Gene Name: PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens ]
• Official Symbol: PDCD1LG2
• Synonyms: PDCD1LG2; programmed cell death 1 ligand 2; B7 dendritic cell molecule; B7 DC; bA574F11.2; Btdc; CD273; PD L2; PDL2; B7-DC; PD-1 ligand 2; PD-1-ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; programmed death ligand 2; B7DC; PD-L2; PDCD1L2; MGC142238; MGC142240
• Gene ID: 80380
• mRNA Refseq: NM_025239
• Protein Refseq: NP_079515
• MIM: 605723
• UniProt ID: Q9BQ51
• Chromosome Location: 9p24.2
• Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem
• Function: molecular_function; protein tyrosine phosphatase activity; receptor activity