Active Recombinant Human NRG4 Protein

• Cat.No.: NRG4-07H
• Product Overview: Recombinant Human Neuregulin-4 EGF domain was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Description: The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation.
• Form: Lyophilized
• Bio-activity: The ED(50) was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be < 3 ng/mL, corresponding to a specific activity of × Units/mg.
• Molecular Mass: Recombinant human Neuregulin-4 EGF domain is a monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE.
• AA Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
• Endotoxin: Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 1 ng/μg (1 EU/μg).
• Purity: >96%, as determined by SDS-PAGE and HPLC
• Usage: This cytokine product is for research purposes only. It may not be used for therapeutics or diagnostic purposes.
• Storage: The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this cytokine can be stored in working aliquots at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Recombinant Neuregulin-4 was lyophilized from 0.2 μm filtered PB, pH7.0.
• Reconstitution: A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 1 mg/mL. This solution can then be diluted into other buffers.

Gene Information

• Gene Name: NRG4 neuregulin 4 [ Homo sapiens (human) ]
• Official Symbol: NRG4
• Synonyms: NRG4; neuregulin 4; HRG4; pro-neuregulin-4, membrane-bound isoform; heregulin 4; pro-NRG4
• Gene ID: 145957
• mRNA Refseq: NM_138573
• Protein Refseq: NP_612640
• MIM: 610894
• UniProt ID: Q8WWG1