Active Recombinant Human NMNAT1, His-tagged

Description :	This gene encodes an enzyme which catalyzes a key step in the biosynthesis of the coenzyme NAD. The encoded protein is one of several nicotinamide nucleotide adenylyltransferases. Studies in Drosophila and mammalian neurons have shown the encoded protein can confer protection to damaged neurons. This protection requires enzymatic activity which increases NAD levels and activates a nuclear deacetylase which is the protective molecule. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14 and 15.
Source :	E.coli
Species :	Human
Tag :	His
Form :	40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 256 mM imidazole and 20% glycerol
Bio-activity :	4200 pmol/min/μg Assay Conditions: The 50 μL reaction mixture contained 50 mM Tris-HCl, pH 7.4, 5 mM MgCl2, 0.1 mM NMN, 0.1 mM ATP, and various amounts of NMNAT.
Molecular Mass :	32.8 kDa
AA Sequence :	MHHHHHHENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGD AYKKKGLIPAYHRVI MAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDC DHQQNSPTLERPGRKRKWTETQDSSQKKSLE PKTKAVPKVKLLCGADLLESFAVPNL WKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEW IANDISSTKIRRA LRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
Purity :	≥95%
Applications :	Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Stability :	>6 months at –80°C

Gene Name	NMNAT1 nicotinamide nucleotide adenylyltransferase 1 [ Homo sapiens (human) ]
Official Symbol	NMNAT1
Synonyms	NMNAT1; LCA9; NMNAT; PNAT1; nicotinamide nucleotide adenylyltransferase 1; NMN adenylyltransferase 1; NaMN adenylyltransferase 1; pyridine nucleotide adenylyltransferase 1; nicotinate-nucleotide adenylyltransferase 1; EC 2.7.7.1; EC 2.7.7.18
Gene ID	64802
mRNA Refseq	NM_022787
Protein Refseq	NP_073624
MIM	608700
UniProt ID	Q9HAN9
Chromosome Location	1p36.22
Pathway	Metabolism; Metabolism of vitamins and cofactors; Metabolism of water-soluble vitamins and cofactors
Function	ATP binding; nicotinamide-nucleotide adenylyltransferase activity; nicotinamide-nucleotide adenylyltransferase activity