Active Recombinant Human NANOG protein, Arginine-tagged

Cat.No. : NANOG-130H
Product Overview : Recombinant human NANOG protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity : DNA binding activity was demonstrated with ELISA using NANOG specific DNA binding oligo.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPH TETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSL QQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWS NQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGE GLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for enhancing PiPS generation efficiency.2. Active protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days
Gene Name NANOG Nanog homeobox [ Homo sapiens ]
Official Symbol NANOG
Synonyms NANOG; Nanog homeobox; homeobox protein NANOG; FLJ12581; FLJ40451; hNanog; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48;
Gene ID 79923
mRNA Refseq NM_024865
Protein Refseq NP_079141
MIM 607937
UniProt ID Q9H9S0
Chromosome Location 12p13.31
Pathway Wnt Signaling Pathway and Pluripotency, organism-specific biosystem;
Function DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NANOG Products

Required fields are marked with *

My Review for All NANOG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon