Active Recombinant Human NANOG protein, Arginine-tagged
Cat.No. : | NANOG-130H |
Product Overview : | Recombinant human NANOG protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
Bio-activity : | DNA binding activity was demonstrated with ELISA using NANOG specific DNA binding oligo. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPH TETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSL QQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWS NQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGE GLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for enhancing PiPS generation efficiency.2. Active protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days |
Gene Name | NANOG Nanog homeobox [ Homo sapiens ] |
Official Symbol | NANOG |
Synonyms | NANOG; Nanog homeobox; homeobox protein NANOG; FLJ12581; FLJ40451; hNanog; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48; |
Gene ID | 79923 |
mRNA Refseq | NM_024865 |
Protein Refseq | NP_079141 |
MIM | 607937 |
UniProt ID | Q9H9S0 |
Chromosome Location | 12p13.31 |
Pathway | Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; |
Function | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
NANOG-3603H | Recombinant Human NANOG, His-tagged | +Inquiry |
NANOG-130H | Active Recombinant Human NANOG protein, Arginine-tagged | +Inquiry |
NANOG-8468H | Recombinant Human NANOG, His-tagged | +Inquiry |
NANOG-4923H | Recombinant Human NANOG protein, His-SUMO-tagged | +Inquiry |
NANOG-14H | Recombinant Human NANOG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NANOG-3981HCL | Recombinant Human NANOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NANOG Products
Required fields are marked with *
My Review for All NANOG Products
Required fields are marked with *
0
Inquiry Basket